I design a peptide D-H-H-H-E-H-H.I would like to characterize the interaction of the peptide and TIM-3. However, the input is wrong. By the way, could you please tell me which college are you in?
Will install demo files.
Copying /service/env/PEPFOLD3/demo/3e21.fst as peptide.
Reference size is 40
PEP-FOLD 3 Initial start: False
PEP-FOLD 3 : Sorry, incorrect command line.
Custom_Peptide_2025|Length=7|Charge=-1
DHHHEHH
2OYP_1|Chain A|Hepatitis A virus cellular receptor 2|Mus musculus (10090)
MDGYKVEVGKNAYLPCSYTLPTSGTLVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIK
Session information:
- id: C10687529150963
- email: None
- activated?: True
- authenticated?: False
Job information:
- id: RPBS Web Portal
- date: Wed, 16 Apr 2025 04:56:28 +0000
- status: error
- user error in parameter: None
- user error message: None